Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Biopolymer transport protein exbB (exbB)

This Recombinant Biopolymer transport protein exbB (exbB) spans the amino acid sequence from region 1-220.

Product Specifications

Product Name Alternative

Biopolymer transport protein exbB

UniProt

O06433

Expression Region

1-220

Origin

Neisseria gonorrhoeae

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLKLVFESGDPVLIGVFVLMLLMSTVTWCLVVLRCIKLYRARKGNAAVKRHMRDTLSLN DAVEKVRAVDAPLSKLAQEALQSYRNYRRNEASELAQALPLNEYLVIQIRNSMAQIMRRF DYGMTALASIGATAPFIGLFGTVWGIYHALINIGQSGQMSIAAVAGPIGEALVATAAGLF VAIPAVLAYNFLNRGTKILTQDLDAMAHDLHVRLLNQKDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ITPK1 (NM_014216) Human Recombinant Protein
TP304537L 1 mg

ITPK1 (NM_014216) Human Recombinant Protein

Sign In for Pricing
View Details
B3GAT1 Rabbit Polyclonal Antibody
HA500443 100 µL

B3GAT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FMO3 (N-term) Rabbit Polyclonal Antibody
AP17395PU-N 400 µL

FMO3 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Accuris qMAX Green, qPCR mix with blue tracking dye, Low Rox qPCR Mix, 500 reactions
PR2000-L-500 1 Each

Accuris qMAX Green, qPCR mix with blue tracking dye, Low Rox qPCR Mix, 500 reactions

Sign In for Pricing
View Details
Fodrin / Alpha Spectrin II (SPTAN1) / NEAS (SPTAN1/3351), CF594 conjugate, 0.1mg/mL
BNC943351-500 1x 500 µL

Fodrin / Alpha Spectrin II (SPTAN1) / NEAS (SPTAN1/3351), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Lusvertikimab Biosimilar - Research Grade
ICH5183-1mg 1 mg

Lusvertikimab Biosimilar - Research Grade

Sign In for Pricing
View Details