Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1283 (MJ1283)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1283 (MJ1283) spans the amino acid sequence from region 1-220.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ1283

UniProt

Q58679

Expression Region

1-220

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVEMNKRGQFFIIGGVILSIGLILFFLLGFNSYTSDGSYLTVFKMKDVKNSIESCLINSL TSNSNLSKNLDMLKNNYKDEGIEINYKKIIFSNIRYEAKNLTFNFSLYNGNFSYNISNYG FGGAFNGSLNVSNYVFSKNLLLNISENGSVTGSFNITGSYVNVFVYDRFGNLILNETIYN NSNEKSLYYYILNVSKEGILLYLLWQRMFLTTHWQKMYPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BAP1 (BRCA1 Associated Protein 1) (BAP1/2432), CF488A conjugate, 0.1mg/mL
BNC882432-100 1x 100 µL

BAP1 (BRCA1 Associated Protein 1) (BAP1/2432), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Taf15 activation kit by CRISPRa
GA208523 1 Kit

Mouse Taf15 activation kit by CRISPRa

Sign In for Pricing
View Details
OPA3 Mouse Monoclonal Antibody [Clone ID: OTI2F5]
CF809451 100 µg

OPA3 Mouse Monoclonal Antibody [Clone ID: OTI2F5]

Sign In for Pricing
View Details
KLF5 Recombinant Rabbit monoclonal Antibody
HA751557 100 µL

KLF5 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
CD151 Human Gene Knockout Kit (CRISPR)
KN400375 1 Kit

CD151 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
WNT3A Mouse Monoclonal Antibody [Clone ID: 3A6]
AM09053PU-S 50 µL

WNT3A Mouse Monoclonal Antibody [Clone ID: 3A6]

Sign In for Pricing
View Details