Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Capsular polysaccharide biosynthesis protein CapA (capA)

This Recombinant Staphylococcus aureus Capsular polysaccharide biosynthesis protein CapA (capA) spans the amino acid sequence from region 1-220.

Product Specifications

Product Name Alternative

Capsular polysaccharide biosynthesis protein CapA

UniProt

Q6GDE0

Expression Region

1-220

Origin

Staphylococcus aureus (strain MRSA252)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKEKFDLVKLLNILKKNIKLLLILPAICLVVSAALTFFVMPDKYTASTQILVNMKKSSSD LAFQNVQSSLQSVNTYTEIIKSPRILDKVSREFDGQYSTAELNSFLKVTNQTNSQIITVS VTTGNKSESDKIVNRISKVFAHDMPKIMSVDNVTILSSAHDNAVKVSPIVSVNLVISIIV GIVLAILIIFLKELLDKRIKTEEDVESQLGLPILGSIQKF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC388282 (NM_001278081) Human Tagged ORF Clone
RC236270 10 µg

LOC388282 (NM_001278081) Human Tagged ORF Clone

Sign In for Pricing
View Details
CASP9 AAV Vector (Human) (CMV)
15079101 1 µg

CASP9 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Anti-CD13 Rabbit Monoclonal Antibody
MA1692-.05 50 µL

Anti-CD13 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CCDC127 Protein Vector (Rat) (pPB-C-His)
PV257866 500 ng

CCDC127 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
DES Conjugated Antibody
MBS9452172-01 0.1 mL (Biotin)

DES Conjugated Antibody

Sign In for Pricing
View Details
DES Conjugated Antibody
MBS9452172-02 0.1 mL (AF350)

DES Conjugated Antibody

Sign In for Pricing
View Details