Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas aeruginosa Elastase (lasB)

Product Specifications

Product Name Alternative

(Neutral metalloproteinase) (PAE) (Pseudolysin)

Abbreviation

Recombinant Pseudomonas aeruginosa lasB protein

Gene Name

LasB

UniProt

P14756

Expression Region

198-498aa

Organism

Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

Target Sequence

AEAGGPGGNQKIGKYTYGSDYGPLIVNDRCEMDDGNVITVDMNSSTDDSKTTPFRFACPTNTYKQVNGAYSPLNDAHFFGGVVFKLYRDWFGTSPLTHKLYMKVHYGRSVENAYWDGTAMLFGDGATMFYPLVSLDVAAHEVSHGFTEQNSGLIYRGQSGGMNEAFSDMAGEAAEFYMRGKNDFLIGYDIKKGSGALRYMDQPSRDGRSIDNASQYYNGIDVHHSSGVYNRAFYLLANSPGWDTRKAFEVFVDANRYYWTATSNYNSGACGVIRSAQNRNYSAADVTRAFSTVGVTCPSAL

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Others

Relevance

Cleaves host elastin, collagen, IgG, and several complement components as well as endogenous pro-aminopeptidase. Autocatalyses processing of its pro-peptide. Processes the pro-peptide of pro-chitin-binding protein (cbpD) . Involved in the pathogenesis of P.aeruginosa infections.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

35.2 kDa

References & Citations

"Molecular characterization and nucleotide sequence of the Pseudomonas aeruginosa elastase structural gene."Bever R.A., Iglewski B.H.J. Bacteriol. 170:4309-4314 (1988)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

0610010F05Rik Mouse qPCR Template Standard (NM_027860)
MK204392 1 Kit

0610010F05Rik Mouse qPCR Template Standard (NM_027860)

Sign In for Pricing
View Details
CDT1 Protein Vector (Rat) (pPB-C-His)
PV259218 500 ng

CDT1 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Rabbit Polyclonal TFIIE beta Antibody
NBP3-28990 100 µg

Rabbit Polyclonal TFIIE beta Antibody

Sign In for Pricing
View Details
Rhod-5N AM
MBS5797545 Inquire

Rhod-5N AM

Sign In for Pricing
View Details
Biotinylated CD47 Fc Chimera Protein, Human
UA010007-01 25 µg

Biotinylated CD47 Fc Chimera Protein, Human

Sign In for Pricing
View Details
Biotinylated CD47 Fc Chimera Protein, Human
UA010007-02 100 µg

Biotinylated CD47 Fc Chimera Protein, Human

Sign In for Pricing
View Details