Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat NEDD4 family-interacting protein 1 (Ndfip1)

This Recombinant Rat NEDD4 family-interacting protein 1 (Ndfip1) spans the amino acid sequence from region 1-221.

Product Specifications

Product Name Alternative

NEDD4 family-interacting protein 1

UniProt

Q5U2S1

Expression Region

1-221

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALALAALAAVEPACGTGYQQLQNEEEPGEREQTAGDAPPPYSSISAESAAYFDYKDESG FPKPPSYNVATTLPSYDEAERTKAEATIPLVPGRDEDFVGRDDFDDADQLRIGNDGIFML TFFMAFLFNWIGFFLSFCLTTSAAGRYGAISGFGLSLIKWILIVRFSTYFPGYFDGQYWL WWVFLVLGFLLFLRGFINYAKVRKMPETFSNLPRTRVLFIY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RO (190-2F2.5), CF405S conjugate, 0.1mg/mL
BNC041081-500 1x 500 µL

CD45RO (190-2F2.5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF740 conjugate, 0.1mg/mL
BNC740178-500 1x 500 µL

CD50 (ICAM-3) (186-2G9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF488A conjugate, 0.1mg/mL
BNC880009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF640R conjugate, 0.1mg/mL
BNC400009-100 1x 100 µL

MART-1 / Melan-A (M2-7C10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF594 conjugate, 0.1mg/mL
BNC940031-100 1x 100 µL

Mucin 5AC (MUC5AC) (45M1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF405S conjugate, 0.1mg/mL
BNC040152-100 1x 100 µL

CD11c (HC1/1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details