Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Candida albicans Mitochondrial intermembrane space import and assembly protein 40 (MIA40)

This Recombinant Candida albicans Mitochondrial intermembrane space import and assembly protein 40 (MIA40) spans the amino acid sequence from region 32-252.

Product Specifications

Product Name Alternative

Mitochondrial intermembrane space import and assembly protein 40, Mitochondrial import inner membrane translocase TIM40

UniProt

O94030

Expression Region

32-252

Origin

Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SQYNSKLLLGVLGTGALAFGYFSQQSSLIQNASTAENIEKVFEEGNAVAKDAQESLDARQ EKVIKENEQKTKKAEDAKTSSESKANVADKKSNSQPEGEPEGEGKQEAAFNPDTGEINWD CPCLGGMAHGPCGEEFKEAFSCFVFSETEPKGIDCIKKFENMRSCFKRYPEHYKDELYDD GEEEASTEVVEHVVLETSEPAIEQIEQGIKEDKVKPNTKSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat SLC25A25 Protein, His (Fc)-Avi-tagged
SLC25A25-5131R 50 µg

Recombinant Rat SLC25A25 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Leptospira spp. PCR kit
PCR-VH089-48D 50T

Leptospira spp. PCR kit

Sign In for Pricing
View Details
U-99194-d6 Maleate Salt
TRC-U100242-100MG 100 mg

U-99194-d6 Maleate Salt

Sign In for Pricing
View Details
Mouse CD72 shRNA Plasmid
abx969580-01 150 µg

Mouse CD72 shRNA Plasmid

Sign In for Pricing
View Details
Mouse CD72 shRNA Plasmid
abx969580-02 300 µg

Mouse CD72 shRNA Plasmid

Sign In for Pricing
View Details
Tgm2 ORF Vector (Mouse) (pORF)
ORF059497 1.0 µg DNA

Tgm2 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details