Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Glycine max Chlorophyll a-b binding protein 2, chloroplastic (CAB2)

This Recombinant Glycine max Chlorophyll a-b binding protein 2, chloroplastic (CAB2) spans the amino acid sequence from region 35-256.

Product Specifications

Product Name Alternative

Chlorophyll a-b binding protein 2, chloroplastic, LHCII type I CAB-2, LHCP

UniProt

P09755

Expression Region

35-256

Origin

Glycine max (Soybean) (Glycine hispida)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

RKTAPKTVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFHGLSADPETFAKNRELEVIHSR WAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWAT QVILMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEALAELKVKELKNGRLAMFS MFGFFVQAIVTGKGPLENLADHLADPVNNNAWAYATKLCPGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRIN2C Polyclonal Antibody
E-AB-90761-01 60 µL

GRIN2C Polyclonal Antibody

Sign In for Pricing
View Details
GRIN2C Polyclonal Antibody
E-AB-90761-02 120 µL

GRIN2C Polyclonal Antibody

Sign In for Pricing
View Details
GRIN2C Polyclonal Antibody
E-AB-90761-03 200 µL

GRIN2C Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Fzd3 activation kit by CRISPRa
GA201494 1 Kit

Mouse Fzd3 activation kit by CRISPRa

Sign In for Pricing
View Details
YIF1B (NM_001145462) Human Over-expression Lysate
LY428905 100 µg

YIF1B (NM_001145462) Human Over-expression Lysate

Sign In for Pricing
View Details
Golgi Complex (AE-6), Biotin conjugate, 0.1mg/mL
BNCB0868-500 1x 500 µL

Golgi Complex (AE-6), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details