Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dense granule protein 3 (GRA3)

This Recombinant Dense granule protein 3 (GRA3) spans the amino acid sequence from region 1-222.

Product Specifications

Product Name Alternative

Dense granule protein 3, P30

UniProt

B6KEU8

Expression Region

1-222

Origin

Toxoplasma gondii

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDRTICPFFIQSFTMSTALKRLIPFLVPFVVFLVAAALGGLAADQPGNHQALAEPVTGVG EAGVSPVNEAGESYSSATSGVQEATAPGAVLLEAIDAESDKVDNQAEGGERMKKVEEELS LLRRELYDRTDRPGLKRAVILSLGTSALIAGRMFSSTLRAAVPWYAVAFNAIVAAYYIRK VLTYRRRVMTKRQPFMSSVKNFFRRRPKDGGAGVDKASKKQT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Kv channel-interacting protein 1, Kcnip1 ELISA KIT
ELI-12821m 96 Tests

Mouse Kv channel-interacting protein 1, Kcnip1 ELISA KIT

Sign In for Pricing
View Details
CDK5RAP1 Polyclonal Antibody, PE-Cy7 Conjugated
bs-9075R-PE-Cy7 100 µL

CDK5RAP1 Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
HiStaph™ Identification Kit
KB004-20KT 1 unit

HiStaph™ Identification Kit

Sign In for Pricing
View Details
Rat Amylase, Alpha 2A (AMY2A) ELISA Kit
EKU11696 96 Tests

Rat Amylase, Alpha 2A (AMY2A) ELISA Kit

Sign In for Pricing
View Details
SIX1 (Homeobox Protein SIX1, Sine Oculis Homeobox Homolog 1) APC
MBS6139067-01 0.1 mL

SIX1 (Homeobox Protein SIX1, Sine Oculis Homeobox Homolog 1) APC

Sign In for Pricing
View Details
SIX1 (Homeobox Protein SIX1, Sine Oculis Homeobox Homolog 1) APC
MBS6139067-02 5x 0.1 mL

SIX1 (Homeobox Protein SIX1, Sine Oculis Homeobox Homolog 1) APC

Sign In for Pricing
View Details