Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dense granule protein 3 (GRA3)

This Recombinant Dense granule protein 3 (GRA3) spans the amino acid sequence from region 1-222.

Product Specifications

Product Name Alternative

Dense granule protein 3, P30

UniProt

B6KEU8

Expression Region

1-222

Origin

Toxoplasma gondii

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDRTICPFFIQSFTMSTALKRLIPFLVPFVVFLVAAALGGLAADQPGNHQALAEPVTGVG EAGVSPVNEAGESYSSATSGVQEATAPGAVLLEAIDAESDKVDNQAEGGERMKKVEEELS LLRRELYDRTDRPGLKRAVILSLGTSALIAGRMFSSTLRAAVPWYAVAFNAIVAAYYIRK VLTYRRRVMTKRQPFMSSVKNFFRRRPKDGGAGVDKASKKQT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thermometer -1 to 51C (0.2)
THE1368 1 Each

Thermometer -1 to 51C (0.2)

Sign In for Pricing
View Details
PRDM1 (NM_001198) Human Recombinant Protein
TP762277 50 µg

PRDM1 (NM_001198) Human Recombinant Protein

Sign In for Pricing
View Details
RGD1563669 Protein Vector (Rat) (pPM-C-HA)
PV300756 500 ng

RGD1563669 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Bacillus anthracis Proline--tRNA ligase 2 (proS2), partial
MBS1394199 Inquire

Recombinant Bacillus anthracis Proline--tRNA ligase 2 (proS2), partial

Sign In for Pricing
View Details
CYP2A7 Rabbit Polyclonal Antibody
orb578222 100 µL

CYP2A7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
1-[4- (4-ethylpiperazin-1-yl) -3-fluorophenyl]ethanone
sc-333536A 5 g

1-[4- (4-ethylpiperazin-1-yl) -3-fluorophenyl]ethanone

Sign In for Pricing
View Details