Recombinant Rat Probable N-acetyltransferase CML6 (Cml6)
This Recombinant Rat Probable N-acetyltransferase CML6 (Cml6) spans the amino acid sequence from region 1-222.
Product Specifications
Product Name Alternative
Probable N-acetyltransferase CML6, EC= 2.3.1.-, Camello-like protein 1, Camello-like protein 6
UniProt
Q9JIY6
Expression Region
1-222
Origin
Rattus norvegicus (Rat)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MVSYHICEYQDSDYKSVVDVFTKGAEEYIPSTFRHLLLLPRTLLLLLGVSLALVLVSGSW LLAVVCIFFLLPFLWFLAGQPWKNYVSKCLHTDMADITKSYLSDRGSGFWVAESGEQVVG TVGALPVKEPPSGRKQLQLFHLAVSSQHRGQGIAKALVRTVLQFARDQGYTDVVLETSTM QIGAVTLYLGMGFQKTGQYFPSMLWRLVGIRFVQLNYSFPSA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470218-500 1x 500 µL
CD100 (Semaphorin-4D) (A8), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941037-500 1x 500 µL
CD44 Standard (DF1485), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740460-500 1x 500 µL
CD44 Standard (156-3C11), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680257-500 1x 500 µL
Cytokeratin, HMW (AE-3), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details