Recombinant Rat N-acetyltransferase 8 (Nat8)
This Recombinant Rat N-acetyltransferase 8 (Nat8) spans the amino acid sequence from region 1-222.
Product Specifications
Product Name Alternative
N-acetyltransferase 8, EC= 2.3.1.-, Camello-like protein 4
UniProt
Q9QXT3
Expression Region
1-222
Origin
Rattus norvegicus (Rat)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MASFHIRQFQERDYEQVVDMFSRGMKEHIPTAFRHLLLLPRTLLLLLGVPLALVLVSGSW LLAVVCIFFLLPFLWFLAGQPWKNYVSKCLHTDMADITKSYLSDRGSGFWVAESGGQIVG TVGALPVKDPPSGRKQLQLFRLSVSSQHRGQGIAKALVRTVLQFARDQGYTDVVLVTGLL QQGAVTLYYSMGFQKTGESFMDILTWLVDVSLIHFIYPLPSS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880158-500 1x 500 µL
Cytokeratin 17 (E3), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680096-100 1x 100 µL
Histone H1 (AE-4), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC700745-100 1x 100 µL
CD45 / LCA (2B11 + PD7/26), CF770 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680050-500 1x 500 µL
IgA Secretory Component (SC05), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details