Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Probable N-acetyltransferase CML1 (Cml1)

This Recombinant Mouse Probable N-acetyltransferase CML1 (Cml1) spans the amino acid sequence from region 1-222.

Product Specifications

Product Name Alternative

Probable N-acetyltransferase CML1, EC= 2.3.1.-, Camello-like protein 1

UniProt

Q9JIZ0

Expression Region

1-222

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVPYHIRQYQDSDHKRVVDVFTKGMEEYIPSTFRHMLMLPRTLLLLLGVPLALVLVSGSW ILAVICIFFLLLLLRLLARQPWKEYVAKCLQTDMVDITKSYLNVHGACFWVAESGGQVVG IVAAQPVKDPPLGRKQLQLFRLSVSSQHRGQGIAKALTRTVLQFARDQSYSDVVLETSAL QQGAVTLYLGMGFKKAGQYFMSIFWRLAGICTIQLKYSFPSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human R-spondin-1 ELISA Kit
EK4585 Inquire

Human R-spondin-1 ELISA Kit

Sign In for Pricing
View Details
HX-375-2-WT-4 AB Labels
117079 Roll of 4000 Label(s)

HX-375-2-WT-4 AB Labels

Sign In for Pricing
View Details
Rat Aldehyde oxidase, Aox1 ELISA Kit
MBS1608666-01 48 Well

Rat Aldehyde oxidase, Aox1 ELISA Kit

Sign In for Pricing
View Details
Rat Aldehyde oxidase, Aox1 ELISA Kit
MBS1608666-02 96 Well

Rat Aldehyde oxidase, Aox1 ELISA Kit

Sign In for Pricing
View Details
Rat Aldehyde oxidase, Aox1 ELISA Kit
MBS1608666-03 5x 96 Well

Rat Aldehyde oxidase, Aox1 ELISA Kit

Sign In for Pricing
View Details
Rat Aldehyde oxidase, Aox1 ELISA Kit
MBS1608666-04 10x 96 Well

Rat Aldehyde oxidase, Aox1 ELISA Kit

Sign In for Pricing
View Details