Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat coronavirus Membrane protein (M)

This Recombinant Rat coronavirus Membrane protein (M) spans the amino acid sequence from region 1-222.

Product Specifications

Product Name Alternative

Membrane protein, M protein, E1 glycoprotein, Matrix glycoprotein, Membrane glycoprotein

UniProt

Q9WCD1

Expression Region

1-222

Origin

Rat coronavirus (strain NJ) (RCV-NJ)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

APQTVYEWTADVAVRFLKEWNFLLGIILLFITIILQFGYTSRSMFIYVVKMIILWLMWPL TIVLCIFNCVYALNNVYLGFSIVFTIVSIVMWIMYFVNSIRLFIRTGSWWSFNPETNNLM CIDVKGTVYVRPIIEDYHTLTATNVRGHLYMQGVKLGTGFSLSDLPAYVTVAKVSHLCTY KRAFLDKVDGVSGFAVYVKSKVGNYRLPSNKPSGVDTALLRI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ccl25 Rat shRNA Plasmid (Locus ID 360750)
TL703437 1 Kit

Ccl25 Rat shRNA Plasmid (Locus ID 360750)

Sign In for Pricing
View Details
Monkey beta-CTx (Beta Crosslaps) ELISA Kit
MBS7616777-01 48 Well

Monkey beta-CTx (Beta Crosslaps) ELISA Kit

Sign In for Pricing
View Details
Monkey beta-CTx (Beta Crosslaps) ELISA Kit
MBS7616777-02 96 Well

Monkey beta-CTx (Beta Crosslaps) ELISA Kit

Sign In for Pricing
View Details
Monkey beta-CTx (Beta Crosslaps) ELISA Kit
MBS7616777-03 5x 96 Well

Monkey beta-CTx (Beta Crosslaps) ELISA Kit

Sign In for Pricing
View Details
Monkey beta-CTx (Beta Crosslaps) ELISA Kit
MBS7616777-04 10x 96 Well

Monkey beta-CTx (Beta Crosslaps) ELISA Kit

Sign In for Pricing
View Details
FADS2 shRNA Plasmid (h)
sc-96449-SH 20 µg

FADS2 shRNA Plasmid (h)

Sign In for Pricing
View Details