Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein ZK512.1 (ZK512.1)

This Recombinant Uncharacterized protein ZK512.1 (ZK512.1) spans the amino acid sequence from region 19-240.

Product Specifications

Product Name Alternative

Uncharacterized protein ZK512.1

UniProt

P34639

Expression Region

19-240

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ATWVKITKPTITWEDMEVSLEGEKKFFCGEFDSSFTGRYHWRFNGSSILPERTQIHRNQF VFLAGANAIRNQLPGEYECCVRETLGNACYSRMIVVQNRTDNHNIDMTNSTLLLADEGNT YYIRMHDVKRVEGVKCTLDGVNVDNFKYPFLGRQTKKTVPYHLKIENIERGGEVNCDLRL HKKEIVQKTFDIRLLRGFISSSQLPQFVYLIVFTIIGYILRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Lung
CB505672 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details
CCN3 (NOV) (NM_002514) Human Over-expression Lysate
LY400897 100 µg

CCN3 (NOV) (NM_002514) Human Over-expression Lysate

Sign In for Pricing
View Details
MUC1 (Ab-1227) Antibody
8B8377-AAT 50 µg

MUC1 (Ab-1227) Antibody

Sign In for Pricing
View Details
Zkscan5 Mouse Gene Knockout Kit (CRISPR)
KN520097 1 Kit

Zkscan5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Water Bath BBWA-3205
BBWA-3205 1 Unit

Water Bath BBWA-3205

Sign In for Pricing
View Details
FAM111B Human Gene Knockout Kit (CRISPR)
KN415988 1 Kit

FAM111B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details