Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bat coronavirus HKU5 Non-structural protein 3d (3d)

This Recombinant Bat coronavirus HKU5 Non-structural protein 3d (3d) spans the amino acid sequence from region 1-223.

Product Specifications

Product Name Alternative

Non-structural protein 3d, ns3d, Accessory protein 3d

UniProt

A3EXD4

Expression Region

1-223

Origin

Bat coronavirus HKU5 (BtCoV) (BtCoV/HKU5/2004)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFSPSLFQPLVIQKETHGGEPSSPNHVIACIPLTGYVAALVVNACFYPLLFCLPYSSCR ASVCKTLVLYVLMLYNFILSCILVEDTQQPVGICLMVYCIILMAIWTIDRVRFCLLIRSL RPLIDMRSNFIRVNTVAGGVVIPVNYSKPWFVKNFNQRCRCTNCFFAHSATYLECTFISR FSKTTLVSISDFQLNGSHSTVFVPFNSRDSVPLHIIAPSVLTV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DECR1 Mouse Monoclonal Antibody [Clone ID: OTI5D6]
CF808947 100 µg

DECR1 Mouse Monoclonal Antibody [Clone ID: OTI5D6]

Sign In for Pricing
View Details
Borcs6 Mouse Gene Knockout Kit (CRISPR)
KN500244 1 Kit

Borcs6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GW0742 Sulfoxide
TRC-G930010-5MG 5 mg

GW0742 Sulfoxide

Sign In for Pricing
View Details
N-Benzyl-N-(2-ethoxyphenoxy)ethylamine
TRC-B276505-250MG 250 mg

N-Benzyl-N-(2-ethoxyphenoxy)ethylamine

Sign In for Pricing
View Details
GPRC5B Human Gene Knockout Kit (CRISPR)
KN205201BN 1 Kit

GPRC5B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
XMD 8-92
TRC-X750948-25MG 25 mg

XMD 8-92

Sign In for Pricing
View Details