Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bat coronavirus HKU5 Non-structural protein 3d (3d)

This Recombinant Bat coronavirus HKU5 Non-structural protein 3d (3d) spans the amino acid sequence from region 1-223.

Product Specifications

Product Name Alternative

Non-structural protein 3d, ns3d, Accessory protein 3d

UniProt

A3EXD4

Expression Region

1-223

Origin

Bat coronavirus HKU5 (BtCoV) (BtCoV/HKU5/2004)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFSPSLFQPLVIQKETHGGEPSSPNHVIACIPLTGYVAALVVNACFYPLLFCLPYSSCR ASVCKTLVLYVLMLYNFILSCILVEDTQQPVGICLMVYCIILMAIWTIDRVRFCLLIRSL RPLIDMRSNFIRVNTVAGGVVIPVNYSKPWFVKNFNQRCRCTNCFFAHSATYLECTFISR FSKTTLVSISDFQLNGSHSTVFVPFNSRDSVPLHIIAPSVLTV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPM1B Antibody
KC-7737-01 50 μL

PPM1B Antibody

Sign In for Pricing
View Details
PPM1B Antibody
KC-7737-02 100 µL

PPM1B Antibody

Sign In for Pricing
View Details
PPM1B Antibody
KC-7737-03 1 mL

PPM1B Antibody

Sign In for Pricing
View Details
P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/1423R), 0.2mg/mL
BNUB1423-500 1x 500 µL

P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/1423R), 0.2mg/mL

Sign In for Pricing
View Details
TACC3 Rabbit Polyclonal Antibody
AP01187PU-N 100 µg

TACC3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2,3-Butanedione
TRC-B690030-500ML 500 mL

2,3-Butanedione

Sign In for Pricing
View Details