Recombinant Human coronavirus HKU1 Membrane protein (M)
This Recombinant Human coronavirus HKU1 Membrane protein (M) spans the amino acid sequence from region 1-223.
Product Specifications
Product Name Alternative
Membrane protein, M protein, E1 glycoprotein, Matrix glycoprotein, Membrane glycoprotein
UniProt
Q14EA7
Expression Region
1-223
Origin
Human coronavirus HKU1 (isolate N2) (HCoV-HKU1)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MNESIFPHWNSDQAITFLKEWNFSLGVILLLITIILQFGYTSRSMFVYLIKMIILWLMWP LTIILTIFNCFYALNNIFLGLSILFTIISIVIWILYFVNSIRLFIRTGSWWSFNPETNNL MCIDMKGKMYVRPVIEDYHTLTATVIRGHLYIQGVKLGTGYTLADLPVYVTVAKVQVLCT YKRAFLDKLDVNSGFAVFVKSKVGNYRLPSSKSSGMDTALLRA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470218-500 1x 500 µL
CD100 (Semaphorin-4D) (A8), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941037-500 1x 500 µL
CD44 Standard (DF1485), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740460-500 1x 500 µL
CD44 Standard (156-3C11), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680257-500 1x 500 µL
Cytokeratin, HMW (AE-3), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details