Recombinant Chaetomium globosum Altered inheritance of mitochondria protein 31, mitochondrial (AIM31)
This Recombinant Chaetomium globosum Altered inheritance of mitochondria protein 31, mitochondrial (AIM31) spans the amino acid sequence from region 1-223.
Product Specifications
Product Name Alternative
Altered inheritance of mitochondria protein 31, mitochondrial
UniProt
Q2GMG9
Expression Region
1-223
Origin
Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) (Soil fungus)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MSDRPTQGLTWGPRRDFYNESGSQKIIRKLKEEPLVPIGCILTIAAFTNAYRAMRRGDHH KVQRMFRARVAAQGFTVLAMVGGGMYYAEDRNKRKELGKLKQQQEAEEKRQKWIRELEAR DEEEKALQEMMDKKRKRASERTMRAETGSEGIAAQARAAFKDKANKGEAAGAEKTEAPSQ RADNEKKPAGSGFLGGWFGGSSKTPETPAKDTKGKNLDSESSS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400026-100 1x 100 µL
ACTH (Adrenocorticotrophic Hormone) (AH26), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC682276-100 1x 100 µL
CD52 (Epididymis-Specific Protein 5) (CD52/2276R), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402076-500 1x 500 µL
GFAP (Astrocyte & Neural Stem Cell Marker) (GFAP/2076), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details