Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human coronavirus HKU1 Membrane protein (M)

This Recombinant Human coronavirus HKU1 Membrane protein (M) spans the amino acid sequence from region 1-223.

Product Specifications

Product Name Alternative

Membrane protein, M protein, E1 glycoprotein, Matrix glycoprotein, Membrane glycoprotein

UniProt

Q5MQC7

Expression Region

1-223

Origin

Human coronavirus HKU1 (isolate N1) (HCoV-HKU1)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNKSFLPQFTSDQAVTFLKEWNFSLGVILLFITIILQFGYTSRSMFVYLIKMIILWLMWP LTITLTIFNCFYALNNAFLAFSIVFTIISIVIWILYFVNSIRLFIRTGSWWSFNPETNNL MCIDMKGKMFVRPVIEDYHTLTATVIRGHLYIQGVKLGTGYTLSDLPVYVTVAKVQVLCT YKRAFLDKLDVNSGFAVFVKSKVGNYRLPSSKPSGMDTALLRA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11a (Cris-3), CF543 conjugate, 0.1mg/mL
BNC430151-500 1x 500 µL

CD11a (Cris-3), CF543 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF640R conjugate, 0.1mg/mL
BNC401052-500 1x 500 µL

CD3e (B-B12), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF640R conjugate, 0.1mg/mL
BNC400017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EGFR (Epidermal Growth Factor Receptor) (GFR/2341), CF405S conjugate, 0.1mg/mL
BNC042341-500 1x 500 µL

EGFR (Epidermal Growth Factor Receptor) (GFR/2341), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8 (C-43), CF405S conjugate, 0.1mg/mL
BNC040688-100 1x 100 µL

Cytokeratin 8 (C-43), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TIMP2 (Tissue Inhibitor of Metalloproteinase 2) (TIMP2/2044), CF647 conjugate, 0.1mg/mL
BNC472044-500 1x 500 µL

TIMP2 (Tissue Inhibitor of Metalloproteinase 2) (TIMP2/2044), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details