Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat ADP-ribosylation factor-like protein 6-interacting protein 6 (Arl6ip6)

This Recombinant Rat ADP-ribosylation factor-like protein 6-interacting protein 6 (Arl6ip6) spans the amino acid sequence from region 1-223.

Product Specifications

Product Name Alternative

ADP-ribosylation factor-like protein 6-interacting protein 6, ARL-6-interacting protein 6, Aip-6

UniProt

Q68FV2

Expression Region

1-223

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFVESWRSVGPRRRRQVTPGPVTRSVYSDYTQGNSWSEDGDEGCDQVARDLRAEFSARA SSESKRAPLLPRIGDGSPVLPDKRNGIFPATAAKRTQARRWPIQALSILCSLLFAVLLAF LLAIAYLIVKELHTENSKNEDVVDTGLLGFWSLLIISLTAGLSCCSFSWTVTYFDSFEPG MFPPTPLSPARFKKLTGHSFHMGYSMAILNGVVAALTVAWCLM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (Fn-3), CF647 conjugate, 0.1mg/mL
BNC472848-100 1x 100 µL

Fibronectin (Fn-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF740 conjugate, 0.1mg/mL
BNC740994-100 1x 100 µL

TNF alpha (J2D10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF647 conjugate, 0.1mg/mL
BNC470633-500 1x 500 µL

Von Willebrand Factor (3E2D10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (58M1), CF405S conjugate, 0.1mg/mL
BNC041003-100 1x 100 µL

Mucin 5AC (MUC5AC) (58M1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF647 conjugate, 0.1mg/mL
BNC470851-100 1x 100 µL

HSP60 (LK1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF405S conjugate, 0.1mg/mL
BNC040276-500 1x 500 µL

TAG-72 / CA72.4 (B72.3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details