Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Avian infectious bronchitis virus Membrane protein (M)

This Recombinant Avian infectious bronchitis virus Membrane protein (M) spans the amino acid sequence from region 1-223.

Product Specifications

Product Name Alternative

Membrane protein, M protein, E1 glycoprotein, Matrix glycoprotein, Membrane glycoprotein

UniProt

Q910E2

Expression Region

1-223

Origin

Avian infectious bronchitis virus (strain Gray) (IBV)

Field of Research

Infectious Disease & Virology; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAENCTLDSEQAVLLFKEYNLFITAFLLFLTILLQYGYATRSRTIYILKMIVLWCFWPLN IAVGVISCIYPPNTGGLVAAIILTVFACLSFVGYWIQSCRLFKRCRSWWSFNPESNAVGS ILLTNGQQCNFAIESVPMVLAPIIKNGVLYCEGQWLAKCEPDHLPKDIFVCTPDRRNIYR MVQKYTGDQSGNKKRFATFVYAKQSVDTGELESVATGGSSLYT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IQGAP1 Rabbit Polyclonal Antibody (Carrier-free)
orb3113440 100 µg

IQGAP1 Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
PFKFB2 (D5I5F) Rabbit Monoclonal Antibody
CST 13029T 20 µL

PFKFB2 (D5I5F) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Rabbit Helicobacter pylori cytotoxin-associated gene A protein IgG ELISA KIT
ED0015Rb-01 96 Well

Rabbit Helicobacter pylori cytotoxin-associated gene A protein IgG ELISA KIT

Sign In for Pricing
View Details
MsrQ Antibody
orb821574 2 mg

MsrQ Antibody

Sign In for Pricing
View Details
BRCA1-Associated Protein 1 Antibody / BAP1
orb3066790-01 20 µg

BRCA1-Associated Protein 1 Antibody / BAP1

Sign In for Pricing
View Details
BRCA1-Associated Protein 1 Antibody / BAP1
orb3066790-02 100 µg

BRCA1-Associated Protein 1 Antibody / BAP1

Sign In for Pricing
View Details