Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Membrane-associated progesterone receptor component 2 (PGRMC2)

This Recombinant Human Membrane-associated progesterone receptor component 2 (PGRMC2) spans the amino acid sequence from region 1-223.

Product Specifications

Product Name Alternative

Membrane-associated progesterone receptor component 2, Progesterone membrane-binding protein, Steroid receptor protein DG6

UniProt

O15173

Expression Region

1-223

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAGDGDVKLGTLGSGSESSNDGGSESPGDAGAAAEGGGWAAAALALLTGGGEMLLNVAL VALVLLGAYRLWVRWGRRGLGAGAGAGEESPATSLPRMKKRDFSLEQLRQYDGSRNPRIL LAVNGKVFDVTKGSKFYGPAGPYGIFAGRDASRGLATFCLDKDALRDEYDDLSDLNAVQM ESVREWEMQFKEKYDYVGRLLKPGEEPSEYTDEEDTKDHNKQD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pancreatic Lipase (PNLIP) (NM_000936) Human Recombinant Protein
TP304735M 100 µg

Pancreatic Lipase (PNLIP) (NM_000936) Human Recombinant Protein

Sign In for Pricing
View Details
Transketolase Rabbit polyclonal Antibody
ER62380 100 µL

Transketolase Rabbit polyclonal Antibody

Sign In for Pricing
View Details
GRB7 (NM_005310) Human Over-expression Lysate
LY401639 100 µg

GRB7 (NM_005310) Human Over-expression Lysate

Sign In for Pricing
View Details
Human PAI1 Recombinant Rabbit monoclonal Antibody
HA723439H 100 µL

Human PAI1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
RBM3 (NM_006743) Human Over-expression Lysate
LY402015 100 µg

RBM3 (NM_006743) Human Over-expression Lysate

Sign In for Pricing
View Details
Synaptophysin Rabbit Polyclonal Antibody
0407-2 100 µL

Synaptophysin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details