Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Membrane-associated progesterone receptor component 2 (PGRMC2)

This Recombinant Human Membrane-associated progesterone receptor component 2 (PGRMC2) spans the amino acid sequence from region 1-223.

Product Specifications

Product Name Alternative

Membrane-associated progesterone receptor component 2, Progesterone membrane-binding protein, Steroid receptor protein DG6

UniProt

O15173

Expression Region

1-223

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAGDGDVKLGTLGSGSESSNDGGSESPGDAGAAAEGGGWAAAALALLTGGGEMLLNVAL VALVLLGAYRLWVRWGRRGLGAGAGAGEESPATSLPRMKKRDFSLEQLRQYDGSRNPRIL LAVNGKVFDVTKGSKFYGPAGPYGIFAGRDASRGLATFCLDKDALRDEYDDLSDLNAVQM ESVREWEMQFKEKYDYVGRLLKPGEEPSEYTDEEDTKDHNKQD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PART1 Antibody
8C17981-AAT 50 µg

PART1 Antibody

Sign In for Pricing
View Details
Her2 (ERBB2) Rabbit Polyclonal Antibody
AP01452PU-N 100 µg

Her2 (ERBB2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LRP2BP (NM_018409) Human Recombinant Protein
TP319339L 1 mg

LRP2BP (NM_018409) Human Recombinant Protein

Sign In for Pricing
View Details
Polystyrene AM CHO
H25031506.100G 100 g

Polystyrene AM CHO

Sign In for Pricing
View Details
Glycophorin A / CD235a (GYPA/280), CF568 conjugate, 0.1mg/mL
BNC680280-500 1x 500 µL

Glycophorin A / CD235a (GYPA/280), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Endometriotic tissue
CS626007 5x 5 µm

Frozen Tissue Sections, Endometriotic tissue

Sign In for Pricing
View Details