Recombinant Human Membrane-associated progesterone receptor component 2 (PGRMC2)
This Recombinant Human Membrane-associated progesterone receptor component 2 (PGRMC2) spans the amino acid sequence from region 1-223.
Product Specifications
Product Name Alternative
Membrane-associated progesterone receptor component 2, Progesterone membrane-binding protein, Steroid receptor protein DG6
UniProt
O15173
Expression Region
1-223
Origin
Homo sapiens (Human)
Field of Research
Pharmacology & Drug Discovery; Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MAAGDGDVKLGTLGSGSESSNDGGSESPGDAGAAAEGGGWAAAALALLTGGGEMLLNVAL VALVLLGAYRLWVRWGRRGLGAGAGAGEESPATSLPRMKKRDFSLEQLRQYDGSRNPRIL LAVNGKVFDVTKGSKFYGPAGPYGIFAGRDASRGLATFCLDKDALRDEYDDLSDLNAVQM ESVREWEMQFKEKYDYVGRLLKPGEEPSEYTDEEDTKDHNKQD
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC881505-100 1x 100 µL
CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (Ki-1/1505R), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681537-100 1x 100 µL
Beta-2 Microglobulin (Renal Failure &Tumor Marker) (rB2M/961), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNUM1739-50 1x 50 µL
P53 Tumor Suppressor Protein (TP53/1739), 1mg/mL
Sign In for Pricing
View Details 