Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Haemophilus influenzae Uncharacterized protein HI_1594 (HI_1594)

This Recombinant Haemophilus influenzae Uncharacterized protein HI_1594 (HI_1594) spans the amino acid sequence from region 1-223.

Product Specifications

Product Name Alternative

Uncharacterized protein HI_1594

UniProt

P44265

Expression Region

1-223

Origin

Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLIIGLCVVSMLLLSSNTFYLSGGVLGGSLVVNWFYPVLGKFGSILIGFVLALIGFIFCS GTSLIRLIVTFYHWLTMKNEQSENAEQEKSTEELEQIVIVKSDRSETENLDQNYLNVEQN SEIETVKPSLEAENISIGKSSSHLINISGLNPEVSIKSEYELANEENEKPQFSFGFDSES LPSVNLSSDSDEQRVSKNDFVAVWNKPVKTVVQEDLAIKSKCG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF640R conjugate, 0.1mg/mL
BNC400806-100 1x 100 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF405S conjugate, 0.1mg/mL
BNC040253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF405S conjugate, 0.1mg/mL
BNC040032-500 1x 500 µL

MUC2 (CCP58), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF488A conjugate, 0.1mg/mL
BNC880008-100 1x 100 µL

MAGE A1 (MA454), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF488A conjugate, 0.1mg/mL
BNC880342-500 1x 500 µL

CD43 (84-3C1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
S100B (4C4.9 + S100B/1012), 0.2mg/mL
BNC941204-100 1x 100 µL

S100B (4C4.9 + S100B/1012), 0.2mg/mL

Sign In for Pricing
View Details