Recombinant Cryptococcus neoformans var. neoformans serotype D Mitochondrial intermembrane space import and assembly protein 40 (MIA40)
This Recombinant Cryptococcus neoformans var. neoformans serotype D Mitochondrial intermembrane space import and assembly protein 40 (MIA40) spans the amino acid sequence from region 19-242.
Product Specifications
Product Name Alternative
Mitochondrial intermembrane space import and assembly protein 40, Mitochondrial import inner membrane translocase TIM40
UniProt
P0CM68
Expression Region
19-242
Origin
Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) (Filobasidiella neoformans)
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
STRSGPAPSSLWSSRNAVIAGTTLAITALAVTSERRKVFNESAQKATSPRDSIIAQDSLK ENVHKKSVRQDEFSGESTKPEASTSSDSVEKAADDAAQILEEKEAEASEPSQGAYNPETG EINWDCPCLGGMATGPCGEQFKAAFSCFVYSEAEPKGVDCVELFKVMQDCFREHPEIYGE VDTLGLVLMFYAEIDDDEAPAQEGTMEEKVEAAKEETAAPAAAP
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
#20135 1x 500 µL
CF®633 Rabbit Anti-Rat IgG (H+L), Highly Cross-Adsorbed, 2 mg/mL
Sign In for Pricing
View Details bsm-33036M-BF405 100 µL
Beta-Actin Monoclonal Antibody, AbBy Fluor™ 405 Conjugated
Sign In for Pricing
View Details