Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Exeristes roborator Cytochrome c oxidase subunit 2 (COII)

This Recombinant Exeristes roborator Cytochrome c oxidase subunit 2 (COII) spans the amino acid sequence from region 1-224.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 2, EC= 1.9.3.1, Cytochrome c oxidase polypeptide II

UniProt

P29873

Expression Region

1-224

Origin

Exeristes roborator (Parasitoid wasp)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTWSMMNLQDANSPMMEQLIFFHDHTLMILLLITITIIYIISSIIMNNLTNKFIMQNQT IEIIWTIIPMIILIYMAIPSLKILYLNDEINNPLMTIKSIGHQWYWSYEYSDFKNIDFNS FMINSKNLNHFRLLDVDNRMIIPMNNQIRMLINSADVIHSWTVPSLGVKIDSVPGRINQT LMMINRPGIYFGQCSEICGMNHSFMPIVIESTSNNNFISWLKSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement C4d (C4D204), CF405S conjugate, 0.1mg/mL
BNC040204-100 1x 100 µL

Complement C4d (C4D204), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF647 conjugate, 0.1mg/mL
BNC470177-500 1x 500 µL

CD50 (ICAM-3) (101-1D2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF640R conjugate, 0.1mg/mL
BNC400158-100 1x 100 µL

Cytokeratin 17 (E3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF594 conjugate, 0.1mg/mL
CD74 (BU45), CF640R conjugate, 0.1mg/mL
BNC400189-100 1x 100 µL

CD74 (BU45), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), 0.2mg/mL
BNUB0266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), 0.2mg/mL

Sign In for Pricing
View Details