Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Avian infectious bronchitis virus Membrane protein (M)

This Recombinant Avian infectious bronchitis virus Membrane protein (M) spans the amino acid sequence from region 1-225.

Product Specifications

Product Name Alternative

Membrane protein, M protein, E1 glycoprotein, Matrix glycoprotein, Membrane glycoprotein

UniProt

P05136

Expression Region

1-225

Origin

Avian infectious bronchitis virus (strain 6/82) (IBV)

Field of Research

Infectious Disease & Virology; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDNTTNCTLGTEQAVQLFKEYNLFVTAFLLFLTILLQYGYATRNKVIYILKMIVLWCFWP LNIAVGAISCIYPPNTGGLVAAIILTVFACLSFIGYWIQSFRLFKRCRSWWAFNPESNAV GSILLTNGQQCNFAIESVPMVLSPIIKNGVLYCEGQWLAKCEPDHLPKDIFVCTPDRRNI YRMVQRYTGDQSGNKKRFATFIYVKHSVDTGELESVATGGSSLYT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLDN11 Rabbit Polyclonal Antibody (FITC)
orb2648970 100 µg

CLDN11 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Il1f5 (NM_001146087) Mouse Tagged ORF Clone
MR219404 10 µg

Il1f5 (NM_001146087) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Diflorasone 17-propionate-21-mesylate
446920-01 5 mg

Diflorasone 17-propionate-21-mesylate

Sign In for Pricing
View Details
Diflorasone 17-propionate-21-mesylate
446920-02 25 mg

Diflorasone 17-propionate-21-mesylate

Sign In for Pricing
View Details
OPG Polyclonal Antibody, HRP Conjugated
bs-20624R-HRP-TR 20 µL

OPG Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Cxcl3 Antibody, Biotin conjugated
CSB-PA09239D0Rb-01 50 µg

Cxcl3 Antibody, Biotin conjugated

Sign In for Pricing
View Details