Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Signal peptidase complex subunit 2 (SPCS2)

This Recombinant Human Signal peptidase complex subunit 2 (SPCS2) spans the amino acid sequence from region 2-226.

Product Specifications

Product Name Alternative

Signal peptidase complex subunit 2, EC= 3.4.-.-, Microsomal signal peptidase 25 kDa subunit, SPase 25 kDa subunit

UniProt

Q15005

Expression Region

2-226

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AAAAVQGGRSGGSGGCSGAGGASNCGTGSGRSGLLDKWKIDDKPVKIDKWDGSAVKNSLD DSAKKVLLEKYKYVENFGLIDGRLTICTISCFFAIVALIWDYMHPFPESKPVLALCVISY FVMMGILTIYTSYKEKSIFLVAHRKDPTGMDPDDIWQLSSSLKRFDDKYTLKLTFISGRT KQQREAEFTKSIAKFFDHSGTLVMDAYEPEISRLHDSLAIERKIK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human IL-22 (N297G) (C-hIgG4P Fc)
BP1080-50ug 50 µg

Recombinant Human IL-22 (N297G) (C-hIgG4P Fc)

Sign In for Pricing
View Details
Mouse THEM4 shRNA Plasmid
abx978504-01 150 µg

Mouse THEM4 shRNA Plasmid

Sign In for Pricing
View Details
Mouse THEM4 shRNA Plasmid
abx978504-02 300 µg

Mouse THEM4 shRNA Plasmid

Sign In for Pricing
View Details
Halcinonide Impurity 19
RM-H120319-01 10 mg

Halcinonide Impurity 19

Sign In for Pricing
View Details
Halcinonide Impurity 19
RM-H120319-02 100 mg

Halcinonide Impurity 19

Sign In for Pricing
View Details
Halcinonide Impurity 19
RM-H120319-03 25 mg

Halcinonide Impurity 19

Sign In for Pricing
View Details