Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Signal peptidase complex subunit 2 (SPCS2)

This Recombinant Pongo abelii Signal peptidase complex subunit 2 (SPCS2) spans the amino acid sequence from region 2-226.

Product Specifications

Product Name Alternative

Signal peptidase complex subunit 2, EC= 3.4.-.-, Microsomal signal peptidase 25 kDa subunit, SPase 25 kDa subunit

UniProt

Q5RAY6

Expression Region

2-226

Origin

Pongo abelii (Sumatran orangutan)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AAAAAQGGRSGGIGGCIGAGGASNCGTGSGRSGLLDKWKIDDKPVKIDKWDGSAVKNSLD DSAKKVLLEKYKYVENFGLIDGRLTICTISCFFAIVALIWDYMHPFPESKPVLALCVISY FVMMGILTIYTSYKEKSIFLVAHRKDPTGMDPDDIWQLSSSLKRFDDKYTLKLTFISGRT KQQREAEFTKSIAKFFDHSGTLVMDAYEPEISRLHDSLAIERKIK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant CSN4 Antibody
RC-16550-01 50 μL

Recombinant CSN4 Antibody

Sign In for Pricing
View Details
Recombinant CSN4 Antibody
RC-16550-02 100 µL

Recombinant CSN4 Antibody

Sign In for Pricing
View Details
Recombinant CSN4 Antibody
RC-16550-03 1 mL

Recombinant CSN4 Antibody

Sign In for Pricing
View Details
TINAG (NM_014464) Human Over-expression Lysate
LY402341 100 µg

TINAG (NM_014464) Human Over-expression Lysate

Sign In for Pricing
View Details
WDR44 (NM_019045) Human Over-expression Lysate
LC402730 20 µg

WDR44 (NM_019045) Human Over-expression Lysate

Sign In for Pricing
View Details
1-Dehydro Androsterone
TRC-D229110-1MG 1 mg

1-Dehydro Androsterone

Sign In for Pricing
View Details