Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human coronavirus NL63 Non-structural protein 3 (3)

This Recombinant Human coronavirus NL63 Non-structural protein 3 (3) spans the amino acid sequence from region 1-225.

Product Specifications

Product Name Alternative

Non-structural protein 3, Protein 3, ns3, Accessory protein 3a

UniProt

Q6Q1S1

Expression Region

1-225

Origin

Human coronavirus NL63 (HCoV-NL63)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPFGGLFQLTLESTINKSVANLKLPPHDVTVLRDNLKPVTTLSTITAYLLVSLFVTYFAL FKPLTARGRVACFVLKLLTLFVYVPLLVLFGMYLDSFIIFSTLLFRFIHVGYYAYLYKNF SFVLFNVTKLCFVSGKCWYLEQSFYENRFAAIYGGDHYVVLGGETITFVSFDDLYVAIRG SCEKNLQLMRKVDLYNGAVIYIFAEEPVVGIVYSSQLYEDVPSIN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ldb2 sgRNA CRISPR Lentivector set (Mouse)
K3712601 3x 1.0 µg

Ldb2 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Cytokeratin 19 (k19, k1cs, Keratin 19 Keratin Type i 40kD, krt19) (HRP)
MBS6124124-01 0.1 mL

Cytokeratin 19 (k19, k1cs, Keratin 19 Keratin Type i 40kD, krt19) (HRP)

Sign In for Pricing
View Details
Cytokeratin 19 (k19, k1cs, Keratin 19 Keratin Type i 40kD, krt19) (HRP)
MBS6124124-02 5x 0.1 mL

Cytokeratin 19 (k19, k1cs, Keratin 19 Keratin Type i 40kD, krt19) (HRP)

Sign In for Pricing
View Details
Human Gap junction alpha-1 protein ELISA Kit
MBS9428255-01 96 Tests

Human Gap junction alpha-1 protein ELISA Kit

Sign In for Pricing
View Details
Human Gap junction alpha-1 protein ELISA Kit
MBS9428255-02 5x 96 Tests

Human Gap junction alpha-1 protein ELISA Kit

Sign In for Pricing
View Details
LGR8 (RXFP2) (NM_130806) Human Tagged ORF Clone Lentiviral Particle
RC219765L1V 200 µL

LGR8 (RXFP2) (NM_130806) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details