Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Avian infectious bronchitis virus Membrane protein (M)

This Recombinant Avian infectious bronchitis virus Membrane protein (M) spans the amino acid sequence from region 1-225.

Product Specifications

Product Name Alternative

Membrane protein, M protein, E1 glycoprotein, Matrix glycoprotein, Membrane glycoprotein

UniProt

Q9J3N8

Expression Region

1-225

Origin

Avian infectious bronchitis virus (strain DE072) (IBV)

Field of Research

Infectious Disease & Virology; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSNETNCTLDFEQSVELFKEYNLFITAFLLFLTIILQYGYATRSKFIYILKMIVLWCFWP LNIAVGVISCIYPPNTGGLVAAIILTVFACLSFVGYWIQSIRLFKRCRSWWSFNPESNAV GSILLTNGQQCNFAIESVPTVLSPIIKNGFLYCEGQWLAKCEPDHLPKDIFVCTPDRRNI YRMVQKYTGDQSGNKKRFATFVYAKQSVDTGELESVATGGSSLYT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Il18bp (NM_010531) Mouse Tagged ORF Clone
MG201876 10 µg

Il18bp (NM_010531) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CSNK1G3 (NM_004384) Human Over-expression Lysate
LC401396 20 µg

CSNK1G3 (NM_004384) Human Over-expression Lysate

Sign In for Pricing
View Details
Protein C inhibitor (SERPINA5) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A12]
TA504357AM 100 µL

Protein C inhibitor (SERPINA5) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A12]

Sign In for Pricing
View Details
Glycocholic Acid
TRC-G641370-5G 5 g

Glycocholic Acid

Sign In for Pricing
View Details
Frozen Tissue Blocks, Ovary
CB503937 1 Block

Frozen Tissue Blocks, Ovary

Sign In for Pricing
View Details
PLD5 (NM_001195811) Human Over-expression Lysate
LY434258 100 µg

PLD5 (NM_001195811) Human Over-expression Lysate

Sign In for Pricing
View Details