Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Leucine-rich repeat-containing protein 3 (Lrrc3)

This Recombinant Rat Leucine-rich repeat-containing protein 3 (Lrrc3) spans the amino acid sequence from region 33-257.

Product Specifications

Product Name Alternative

Leucine-rich repeat-containing protein 3

UniProt

P59035

Expression Region

33-257

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CPQSCQCPDHAGAVAVHCSSRGLQEIPRDIPANTVLLKLDANRISRVPNGAFQHLPQLRE LDLSHNAIEAIGPAAFSGLAGGLRLLDLSHNRIRRIPKDALGKLSAKIRLSHNPLHCECA LQEALWELKLDPDSVDEIACHTSAQEQFVGKPLIQVLDSGASFCSTHRKTTDVAMLVTMF GWFTMVIAYVVYYVRHNQEDARRHLEYLKSLPSAPVSKEPLSPVP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF740 conjugate, 0.1mg/mL
BNC741073-500 1x 500 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF568 conjugate, 0.1mg/mL
BNC680342-500 1x 500 µL

CD43 (84-3C1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF488A conjugate, 0.1mg/mL
BNC881050-100 1x 100 µL

CD3e (CRIS-7), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF405S conjugate, 0.1mg/mL
BNC040338-100 1x 100 µL

P53 (PAb122), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prolactin (Pituitary Tumor Marker) (PRL/2643), CF405S conjugate, 0.1mg/mL
BNC042643-100 1x 100 µL

Prolactin (Pituitary Tumor Marker) (PRL/2643), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Smooth Muscle Myosin Heavy Chain (SM-MHC) (MYH11/2303R), CF640R conjugate, 0.1mg/mL
BNC402303-100 1x 100 µL

Smooth Muscle Myosin Heavy Chain (SM-MHC) (MYH11/2303R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details