Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C12orf69 (C12orf69)

This Recombinant Human Uncharacterized protein C12orf69 (C12orf69) spans the amino acid sequence from region 1-225.

Product Specifications

Product Name Alternative

Uncharacterized protein C12orf69

UniProt

A2RU48

Expression Region

1-225

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAQSDFLYPENPKRREEVNRLHQQLLDCLSDSFDVTNKLTEVLNMHLGCRLASIEMKRDG TIKENCDLIIQAIMKIQKELQKVDEALKDKLEPTLYRKLQDIKEKETDKIAIVQKVISVI LGEATSAASAVAVKLVGSNVTTGIINKLVTVLAQIGASLLGSIGVAVLGLGIDMIVRAIL GAVEKTQLQAAIKSYEKHLVEFKSASEKYNHAITEVINTVKHQMK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RIN1 Recombinant Protein Antigen
NBP1-85905PEP 0.1 mL

RIN1 Recombinant Protein Antigen

Sign In for Pricing
View Details
POLE2 Rabbit Polyclonal Antibody
orb588422 100 µL

POLE2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZNF148, NT (ZNF148, ZBP89, Zinc finger protein 148, Transcription factor ZBP-89, Zinc finger DNA-binding protein 89) (Azide free) (HRP)
MBS6365693-01 0.2 mL

ZNF148, NT (ZNF148, ZBP89, Zinc finger protein 148, Transcription factor ZBP-89, Zinc finger DNA-binding protein 89) (Azide free) (HRP)

Sign In for Pricing
View Details
ZNF148, NT (ZNF148, ZBP89, Zinc finger protein 148, Transcription factor ZBP-89, Zinc finger DNA-binding protein 89) (Azide free) (HRP)
MBS6365693-02 5x 0.2 mL

ZNF148, NT (ZNF148, ZBP89, Zinc finger protein 148, Transcription factor ZBP-89, Zinc finger DNA-binding protein 89) (Azide free) (HRP)

Sign In for Pricing
View Details
Liquid Nitrogen Containers
E1253 1 Unit

Liquid Nitrogen Containers

Sign In for Pricing
View Details
Fish Kelch-Like Protein 34 (KLHL34) ELISA Kit
MBS9907452 Inquire

Fish Kelch-Like Protein 34 (KLHL34) ELISA Kit

Sign In for Pricing
View Details