Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C12orf69 (C12orf69)

This Recombinant Human Uncharacterized protein C12orf69 (C12orf69) spans the amino acid sequence from region 1-225.

Product Specifications

Product Name Alternative

Uncharacterized protein C12orf69

UniProt

A2RU48

Expression Region

1-225

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAQSDFLYPENPKRREEVNRLHQQLLDCLSDSFDVTNKLTEVLNMHLGCRLASIEMKRDG TIKENCDLIIQAIMKIQKELQKVDEALKDKLEPTLYRKLQDIKEKETDKIAIVQKVISVI LGEATSAASAVAVKLVGSNVTTGIINKLVTVLAQIGASLLGSIGVAVLGLGIDMIVRAIL GAVEKTQLQAAIKSYEKHLVEFKSASEKYNHAITEVINTVKHQMK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRB2, ID (Growth factor receptor-bound protein 2, Adapter protein GRB2, SH2/SH3 adapter GRB2, Protein Ash, ASH) (AP)
MBS6478946-01 0.2 mL

GRB2, ID (Growth factor receptor-bound protein 2, Adapter protein GRB2, SH2/SH3 adapter GRB2, Protein Ash, ASH) (AP)

Sign In for Pricing
View Details
GRB2, ID (Growth factor receptor-bound protein 2, Adapter protein GRB2, SH2/SH3 adapter GRB2, Protein Ash, ASH) (AP)
MBS6478946-02 5x 0.2 mL

GRB2, ID (Growth factor receptor-bound protein 2, Adapter protein GRB2, SH2/SH3 adapter GRB2, Protein Ash, ASH) (AP)

Sign In for Pricing
View Details
Goat Fibroblast growth factor receptor 3 (FGFR3) ELISA Kit
MBS2802707-01 48 Tests

Goat Fibroblast growth factor receptor 3 (FGFR3) ELISA Kit

Sign In for Pricing
View Details
Goat Fibroblast growth factor receptor 3 (FGFR3) ELISA Kit
MBS2802707-02 96 Tests

Goat Fibroblast growth factor receptor 3 (FGFR3) ELISA Kit

Sign In for Pricing
View Details
Goat Fibroblast growth factor receptor 3 (FGFR3) ELISA Kit
MBS2802707-03 5x 96 Tests

Goat Fibroblast growth factor receptor 3 (FGFR3) ELISA Kit

Sign In for Pricing
View Details
Goat Fibroblast growth factor receptor 3 (FGFR3) ELISA Kit
MBS2802707-04 10x 96 Tests

Goat Fibroblast growth factor receptor 3 (FGFR3) ELISA Kit

Sign In for Pricing
View Details