Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Leucine-rich repeat-containing protein 3 (LRRC3)

This Recombinant Bovine Leucine-rich repeat-containing protein 3 (LRRC3) spans the amino acid sequence from region 33-257.

Product Specifications

Product Name Alternative

Leucine-rich repeat-containing protein 3

UniProt

A6H793

Expression Region

33-257

Origin

Bos taurus (Bovine)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CPQNCQCPDHAGAVAVHCSARGLQEVPRDIPADTVLLKLDANKIARIPNGAFQHLHQLRE LDLSQNAIETIGPAAFSGLAGGLRLLDLSHNRLRRIPKDALGKLSAKIRLAHNPLHCECA LQEALWELKLDPDSVDEIACHTSVQEEYVGKPLIQALDSGVSFCSVHHKTTDVAMLVTMF GWFAMVITYVVYYVRQNQEDARRHLEYLKSLPSTPMSKDPTSSAP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (B-B12), CF594 conjugate, 0.1mg/mL
BNC941052-100 1x 100 µL

CD3e (B-B12), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF740 conjugate, 0.1mg/mL
BNC740806-100 1x 100 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF405S conjugate, 0.1mg/mL
BNC041045-100 1x 100 µL

CD16 (C16/1045), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-x (BX006 + 2H12), CF647 conjugate, 0.1mg/mL
BNC470752-100 1x 100 µL

Bcl-x (BX006 + 2H12), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calponin-1 (CALP + CNN1/832), CF640R conjugate, 0.1mg/mL
BNC400833-100 1x 100 µL

Calponin-1 (CALP + CNN1/832), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), 1mg/mL
BNUM0149-50 1x 50 µL

CD106 / VCAM1 (1.4C3), 1mg/mL

Sign In for Pricing
View Details