Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Avian infectious bronchitis virus Membrane protein (M)

This Recombinant Avian infectious bronchitis virus Membrane protein (M) spans the amino acid sequence from region 1-225.

Product Specifications

Product Name Alternative

Membrane protein, M protein, E1 glycoprotein, Matrix glycoprotein, Membrane glycoprotein

UniProt

P69606

Expression Region

1-225

Origin

Avian infectious bronchitis virus (strain M41) (IBV)

Field of Research

Infectious Disease & Virology; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSNETNCTLDFEQSVELFKEYNLFITAFLLFLTIILQYGYATRSKFIYILKMIVLWCFWP LNIAVGVISCIYPPNTGGLVAAIILTVFACLSFVGYWIQSIRLFKRCRSWWSFNPESNAV GSILLTNGQQCNFAIESVPMVLSPIIKNGVLYCEGQWLAKCEPDHLPKDIFVCTPDRRNI YRMVQKYTGDQSGNKKRFATFVYAKQSVDTGELESVATGGSSLYT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD147 (BSG) (NM_001728) Human Recombinant Protein
TP319464M 100 µg

CD147 (BSG) (NM_001728) Human Recombinant Protein

Sign In for Pricing
View Details
Human IQCD activation kit by CRISPRa
GA114547 1 Kit

Human IQCD activation kit by CRISPRa

Sign In for Pricing
View Details
Filaggrin (Keratinocyte Differentiation Marker) (FLG/1957R), CF488A conjugate, 0.1mg/mL
BNC881957-500 1x 500 µL

Filaggrin (Keratinocyte Differentiation Marker) (FLG/1957R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 19 (KRT19/799), CF740 conjugate, 0.1mg/mL
BNC740799-500 1x 500 µL

Cytokeratin 19 (KRT19/799), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Envoplakin (EVPL) Rabbit Polyclonal Antibody
TA368244 100 µL

Envoplakin (EVPL) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
p-t-Butylphenyl Diphenyl Phosphate-d10
TRC-B699962-25MG 25 mg

p-t-Butylphenyl Diphenyl Phosphate-d10

Sign In for Pricing
View Details