Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Avian infectious bronchitis virus Membrane protein (M)

This Recombinant Avian infectious bronchitis virus Membrane protein (M) spans the amino acid sequence from region 1-225.

Product Specifications

Product Name Alternative

Membrane protein, M protein, E1 glycoprotein, Matrix glycoprotein, Membrane glycoprotein

UniProt

P12649

Expression Region

1-225

Origin

Avian infectious bronchitis virus (strain KB8523) (IBV)

Field of Research

Infectious Disease & Virology; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSNETNCTLDFEQSVELFKEYNLFITAFLLFLTIILQYGYATRIRFIYILKMIVLWCFWP LNIAVGVISCIYPPNTGGLVAAIILTVFACLSFVGYWIQSCRLFKRCRSWWSFNPESNAV GSILLTNGQQCNFAIESVPMVLAPIIKNGVLYCEGQWLAKCEPDHLPKDIFVCTADRRNI YRMVQKYTGDQSGNKKRFATFVYAKQSVDTGELESVATGGSSLYT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ALDH8A1 Antibody
NBP2-84419-0.1mL 0.1 mL

Rabbit Polyclonal ALDH8A1 Antibody

Sign In for Pricing
View Details
WIF-1 (B-10) Alexa Fluor® 790
sc-373780 AF790 200 µg/mL

WIF-1 (B-10) Alexa Fluor® 790

Sign In for Pricing
View Details
Rat PG (Progesterone) ELISA Kit
ELK8385-01 48 Tests

Rat PG (Progesterone) ELISA Kit

Sign In for Pricing
View Details
Rat PG (Progesterone) ELISA Kit
ELK8385-02 96 Tests

Rat PG (Progesterone) ELISA Kit

Sign In for Pricing
View Details
Rat PG (Progesterone) ELISA Kit
ELK8385-03 5x 96 Tests

Rat PG (Progesterone) ELISA Kit

Sign In for Pricing
View Details
Klotho Antibody (Center Region)
F54137-0.05ML 0.05 mL

Klotho Antibody (Center Region)

Sign In for Pricing
View Details