Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human coronavirus 229E Membrane protein (M)

This Recombinant Human coronavirus 229E Membrane protein (M) spans the amino acid sequence from region 1-225.

Product Specifications

Product Name Alternative

Membrane protein, M protein, E1 glycoprotein, Matrix glycoprotein, Membrane glycoprotein

UniProt

P15422

Expression Region

1-225

Origin

Human coronavirus 229E (HCoV-229E)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSNDNCTGDIVTHLKNWNFGWNVILTIFIVILQFGHYKYSRLFYGLKMLVLWLLWPLVLA LSIFDTWANWDSNWAFVAFSFFMAVSTLVMWVMYFANSFRLFRRARTFWAWNPEVNAITV TTVLGQTYYQPIQQAPTGITVTLLSGVLYVDGHRLASGVQVHNLPEYMTVAVPSTTIIYS RVGRSVNSQNSTGWVFYVRVKHGDFSAVSSPMSNMTENERLLHFF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Liver
CS705988 5x 5 µm

Tissue FFPE Sections, Liver

Sign In for Pricing
View Details
Six5 Mouse Gene Knockout Kit (CRISPR)
KN515815 1 Kit

Six5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Butyltin-d9 Trichloride
TRC-B809522-25MG 25 mg

Butyltin-d9 Trichloride

Sign In for Pricing
View Details
Creld2 Mouse Gene Knockout Kit (CRISPR)
KN503819 1 Kit

Creld2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human ST6GALNAC4 activation kit by CRISPRa
GA109001 1 Kit

Human ST6GALNAC4 activation kit by CRISPRa

Sign In for Pricing
View Details
BioWand™ Personal UV Sanitizer
U1001-W 1 Each

BioWand™ Personal UV Sanitizer

Sign In for Pricing
View Details