Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Buxus microphylla Chloroplast envelope membrane protein (cemA)

This Recombinant Buxus microphylla Chloroplast envelope membrane protein (cemA) spans the amino acid sequence from region 1-226.

Product Specifications

Product Name Alternative

Chloroplast envelope membrane protein

UniProt

A6MM48

Expression Region

1-226

Origin

Buxus microphylla (Little leaf boxwood) (Japanese boxwood)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAKKKAFTSLPYLASIVFLPWWISLSFNKWLESWVTNWWNTRQSETFLNDIQEKNILEKF IELEELFLLDEMIKEYPETHIQRRIHKETIQLVKMHNESHIHTILHLSTNIICFAILSGY SILGNEGLFILNSWVQEFLYNLSDTIKAFSILLLTDLCIGFHSPHGWELMIGSVYKDFGF AHNDQIISGLVSTFPVILDTILKYWIFRYLNRVSPSLVVIYHSMND

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-VPS26B antibody
STJ117399 100 µl

Anti-VPS26B antibody

Sign In for Pricing
View Details
MRPL10 (NM_148887) Human Tagged ORF Clone
RC215135 10 µg

MRPL10 (NM_148887) Human Tagged ORF Clone

Sign In for Pricing
View Details
SF20 Recombinant Rabbit mAb
E43S46724 100 µL

SF20 Recombinant Rabbit mAb

Sign In for Pricing
View Details
MTMR3 (NM_021090) Human Untagged Clone
SC111723 10 µg

MTMR3 (NM_021090) Human Untagged Clone

Sign In for Pricing
View Details
Human Urocortin ELISA Kit
MBS9428210-01 96 Tests

Human Urocortin ELISA Kit

Sign In for Pricing
View Details
Human Urocortin ELISA Kit
MBS9428210-02 5x 96 Tests

Human Urocortin ELISA Kit

Sign In for Pricing
View Details