Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Buxus microphylla Chloroplast envelope membrane protein (cemA)

This Recombinant Buxus microphylla Chloroplast envelope membrane protein (cemA) spans the amino acid sequence from region 1-226.

Product Specifications

Product Name Alternative

Chloroplast envelope membrane protein

UniProt

A6MM48

Expression Region

1-226

Origin

Buxus microphylla (Little leaf boxwood) (Japanese boxwood)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAKKKAFTSLPYLASIVFLPWWISLSFNKWLESWVTNWWNTRQSETFLNDIQEKNILEKF IELEELFLLDEMIKEYPETHIQRRIHKETIQLVKMHNESHIHTILHLSTNIICFAILSGY SILGNEGLFILNSWVQEFLYNLSDTIKAFSILLLTDLCIGFHSPHGWELMIGSVYKDFGF AHNDQIISGLVSTFPVILDTILKYWIFRYLNRVSPSLVVIYHSMND

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adra1d sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4447908 1.0 µg DNA

Adra1d sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
CCKAR Antibody
orb223391-01 25 µg

CCKAR Antibody

Sign In for Pricing
View Details
CCKAR Antibody
orb223391-02 50 µg

CCKAR Antibody

Sign In for Pricing
View Details
CCKAR Antibody
orb223391-03 100 µg

CCKAR Antibody

Sign In for Pricing
View Details
CCKAR Antibody
orb223391-04 200 µg

CCKAR Antibody

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YEL028W (YEL028W)
MBS1151068-01 0.02 mg (E-Coli)

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YEL028W (YEL028W)

Sign In for Pricing
View Details