Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Perognathus flavus Cytochrome c oxidase subunit 2 (MT-CO2)

This Recombinant Perognathus flavus Cytochrome c oxidase subunit 2 (MT-CO2) spans the amino acid sequence from region 1-226.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 2, Cytochrome c oxidase polypeptide II

UniProt

Q37595

Expression Region

1-226

Origin

Perognathus flavus (Silky pocket mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAYPLQLGLQDATSPIMEELTSFHDHTLMIVFLISTLVLYIISLMLTTKLTHTSTMDAQE IETIWTILPAIILIMIALPSLRVLYMMDEINNPALTVKTMGHQWYWSYEYTDYEDLSFDS YMVNTTDLKPGDLRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN QATVSSSRPGLFYGQCSEICGSNHSFMPIVLEMVPLKYFEAWSASM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGF-beta (1D11.16.8), CF770 conjugate, 0.1mg/mL
BNC700977-500 1x 500 µL

TGF-beta (1D11.16.8), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF647 conjugate, 0.1mg/mL
BNC471052-500 1x 500 µL

CD3e (B-B12), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HER-2 / c-erbB-2 / neu / CD340 (ERBB2/2452), CF405S conjugate, 0.1mg/mL
BNC042452-500 1x 500 µL

HER-2 / c-erbB-2 / neu / CD340 (ERBB2/2452), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD163 (Monocyte & Macrophage Marker) (M130/1210), CF594 conjugate, 0.1mg/mL
BNC941210-100 1x 100 µL

CD163 (Monocyte & Macrophage Marker) (M130/1210), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Spectrin beta III (SPTBN2) (SPTBN2/1778), CF568 conjugate, 0.1mg/mL
BNC681778-500 1x 500 µL

Spectrin beta III (SPTBN2) (SPTBN2/1778), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pgp9.5 (UCHL-1) (31A3), CF405S conjugate, 0.1mg/mL
BNC040046-500 1x 500 µL

Pgp9.5 (UCHL-1) (31A3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details