Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine ADP-ribosylation factor-like protein 6-interacting protein 6 (ARL6IP6)

This Recombinant Bovine ADP-ribosylation factor-like protein 6-interacting protein 6 (ARL6IP6) spans the amino acid sequence from region 1-226.

Product Specifications

Product Name Alternative

ADP-ribosylation factor-like protein 6-interacting protein 6, ARL-6-interacting protein 6, Aip-6

UniProt

Q3MHM8

Expression Region

1-226

Origin

Bos taurus (Bovine)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFVESGRRSAPLRRRPGTPVPFARPAYSVFSQGDSWGEGEVEEEEGCDQVARDLRAEFS AGSSSKLRKDPVLQPDGDGSPVLPDKRNGIFSADAGGKALARRWPVQVLSILCSLLFAIL LACLLAITYLIVKELHAENLKNEDDVNTGLLGFWSLLIISLTAGFSCCSFSWTVTYFDSF EPGMFPPTPLSPARFKKMTGHSFHMGYSMAILNGIVAALTVAWCLM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGE A1 (MA454), CF488A conjugate, 0.1mg/mL
BNC880008-100 1x 100 µL

MAGE A1 (MA454), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF488A conjugate, 0.1mg/mL
BNC880851-100 1x 100 µL

HSP60 (LK1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF594 conjugate, 0.1mg/mL
BNC940050-100 1x 100 µL

IgA Secretory Component (SC05), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF555 conjugate, 0.1mg/mL
BNC550645-500 1x 500 µL

FOXP3 (3G3), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL
BNC400633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
WIPI2 (2A2), CF647 conjugate, 0.1mg/mL
BNC472904-500 1x 500 µL

WIPI2 (2A2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details