Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Spermatogenesis-associated protein 25 (Spata25)

This Recombinant Mouse Spermatogenesis-associated protein 25 (Spata25) spans the amino acid sequence from region 1-226.

Product Specifications

Product Name Alternative

Spermatogenesis-associated protein 25, Testis-specific gene 23 protein

UniProt

Q9DA57

Expression Region

1-226

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSYFVSPQSHLGLLPSGQGGAASSGSSLGLYSPAEPVVVAPGGLGPLSQKAEQVAPAAQA WGPTLAVPEARGCSGGVSWETPRRKEHNRYCPKLPPMRPLESLGWADPCSRSRAPYLGGP SRPRPLLLCGLSPGVLPISSEAGGKEAASQPDICILTLAMMIAGIPTVPVPGLREEDLIR AAQAFMMAHPEPEGAVEGVQWEQAHAHAHMASGQMPLVRSRRGSCL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PNPLA2 Antibody
OACA05463-100UG 100 µg

PNPLA2 Antibody

Sign In for Pricing
View Details
MOV10 Human Recombinant Protein
TP725165 50 µg

MOV10 Human Recombinant Protein

Sign In for Pricing
View Details
Anti-Centrobin CNTROB Antibody
A08210-1 100 µL

Anti-Centrobin CNTROB Antibody

Sign In for Pricing
View Details
SATB2
E8ET1705-95 100 µL

SATB2

Sign In for Pricing
View Details
Sitafloxacin Impurity 61
RM-S111690-01 10 mg

Sitafloxacin Impurity 61

Sign In for Pricing
View Details
Sitafloxacin Impurity 61
RM-S111690-02 25 mg

Sitafloxacin Impurity 61

Sign In for Pricing
View Details