Recombinant Yop proteins translocation lipoprotein J (yscJ)
This Recombinant Yop proteins translocation lipoprotein J (yscJ) spans the amino acid sequence from region 19-244.
Product Specifications
Product Name Alternative
Yop proteins translocation lipoprotein J, Lipoprotein ylpB, Low calcium response locus protein KA
UniProt
P69972
Expression Region
19-244
Origin
Yersinia pestis
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
CKVDLYTGISQKEGNEMLALLRQEGLSADKEPDKDGKIKLLVEESDVAQAIDILKRKGYP HESFSTLQDVFPKDGLISSPIEELARLNYAKAQEISRTLSEIDGVLVARVHVVLPEEQNN KGKKGVAASASVFIKHAADIQFDTYIPQIKQLVNNSIEGLAYDRISVILVPSVDVRQSSH LPRNTSILSIQVSEESKGHLIGLLSLLILLLPVTNLAQYFWLQRKK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400204-500 1x 500 µL
Complement C4d (C4D204), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741620-100 1x 100 µL
CD10 (Membrane Metalloendopeptidase) (MME/1620), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472711-100 1x 100 µL
Carboxypeptidase A1 / CPA1 (Pancreatic Cancer Marker) (CPA1/2711), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880820-500 1x 500 µL
Caldesmon, HMW (h-Caldesmon) (CALD1/820), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details