Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Probable N-acetyltransferase CML2 (Cml2)

This Recombinant Rat Probable N-acetyltransferase CML2 (Cml2) spans the amino acid sequence from region 1-226.

Product Specifications

Product Name Alternative

Probable N-acetyltransferase CML2, EC= 2.3.1.-, Camello-like protein 2

UniProt

P85118

Expression Region

1-226

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPYHIRQFQDRDHRRVLDLFSRGMEEHVPAAFYHVLTLPHSLLLFPGVPVTIILVSGSW LLATVYSFLFLLCLRLIFWVSCRNYVAKCLQADLADITKSYLNAHGSFWVAESGGQVVGI VAALPVKEPPSGRKQLQLFRLSVSSQHRGQGIAKALVRIVLQFARDQGYTDVVLVTGNMQ YSAISLYQGMGFQKTGHYFVSIAKRLIGLSIFHFTYSLPSVWEPRM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phenylboronic Acid-13C6
TRC-P319593-50MG 50 mg

Phenylboronic Acid-13C6

Sign In for Pricing
View Details
Epstein-Barr Virus (LMP-1) (CS1), CF640R conjugate, 0.1mg/mL
BNC401741-100 1x 100 µL

Epstein-Barr Virus (LMP-1) (CS1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Arachidonic Acid N-Hydroxysuccinimidyl Ester
TRC-A765010-5MG 5 mg

Arachidonic Acid N-Hydroxysuccinimidyl Ester

Sign In for Pricing
View Details
Ephrin B3 (EFNB3) Rabbit Polyclonal Antibody
AP06105PU-N 100 µg

Ephrin B3 (EFNB3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD43 (T-Cell Marker) (SPN/2049R), CF640R conjugate, 0.1mg/mL
BNC402049-100 1x 100 µL

CD43 (T-Cell Marker) (SPN/2049R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Involucrin (SY5), 0.2mg/mL
BNUB0678-500 1x 500 µL

Involucrin (SY5), 0.2mg/mL

Sign In for Pricing
View Details