Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant General secretion pathway protein B (exeB)

This Recombinant General secretion pathway protein B (exeB) spans the amino acid sequence from region 1-226.

Product Specifications

Product Name Alternative

General secretion pathway protein B

UniProt

P45755

Expression Region

1-226

Origin

Aeromonas hydrophila

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTLLKALRRAEQPQFTPHIPAMGLPVTQEEEQNRRWIWWLLAPLALLMGAGANYGWHLL NNRPIEKTVEVKEVVTPPFVRVEPRPMITRPLPPPLPEPVVRPRVTPNDSAPAANGSQGL AERIMNALNSTPLMEETAPQAQSESQAMPISALPLELKQRVPPLAYGSHVFSSNPAKRAV MLNGREFREGSEVAPGVTLIAIAQDYIILQVAGQNVSLKALQDWRG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,3,5-Tri-O-benzoyl-2-O- (trifluoromethanesulfonyl) -a-D-ribofuranose
MT07900-01 25 mg

1,3,5-Tri-O-benzoyl-2-O- (trifluoromethanesulfonyl) -a-D-ribofuranose

Sign In for Pricing
View Details
1,3,5-Tri-O-benzoyl-2-O- (trifluoromethanesulfonyl) -a-D-ribofuranose
MT07900-02 50 mg

1,3,5-Tri-O-benzoyl-2-O- (trifluoromethanesulfonyl) -a-D-ribofuranose

Sign In for Pricing
View Details
1,3,5-Tri-O-benzoyl-2-O- (trifluoromethanesulfonyl) -a-D-ribofuranose
MT07900-03 100 mg

1,3,5-Tri-O-benzoyl-2-O- (trifluoromethanesulfonyl) -a-D-ribofuranose

Sign In for Pricing
View Details
1,3,5-Tri-O-benzoyl-2-O- (trifluoromethanesulfonyl) -a-D-ribofuranose
MT07900-04 250 mg

1,3,5-Tri-O-benzoyl-2-O- (trifluoromethanesulfonyl) -a-D-ribofuranose

Sign In for Pricing
View Details
1,3,5-Tri-O-benzoyl-2-O- (trifluoromethanesulfonyl) -a-D-ribofuranose
MT07900-05 500 mg

1,3,5-Tri-O-benzoyl-2-O- (trifluoromethanesulfonyl) -a-D-ribofuranose

Sign In for Pricing
View Details
MFluor™ Red 780 Anti-human CD64 Antibody *10.1*
106400W0-AAT 100 Tests

MFluor™ Red 780 Anti-human CD64 Antibody *10.1*

Sign In for Pricing
View Details