Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Equine herpesvirus 4 Envelope protein UL45 homolog (15)

This Recombinant Equine herpesvirus 4 Envelope protein UL45 homolog (15) spans the amino acid sequence from region 1-226.

Product Specifications

Product Name Alternative

Envelope protein UL45 homolog

UniProt

P22598

Expression Region

1-226

Origin

Equine herpesvirus 4 (strain 1942) (EHV-4) (Equine rhinopneumonitis virus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGDPTASLKDYQLLELDTAAGNDQAPQLPTKTVLGFTPPLPTLPQPTELVYTKRRRPKR RSRCRCLCFTMGMFAMGVLMTTTLLVSTFVLTVPMVALRTAPCPAQTFGLGDECVRPVSL DAYNSSNSSEIGAVCGAYSEMPAPDNTTVLIMNLLDCLNIGINESAGEKLNLTDTPLANC NFSQNSVCSRKRVGVCYAARPLSPLGELIYKARQALRLDHILPFLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD53 (161-2), CF488A conjugate, 0.1mg/mL
BNC880324-100 1x 100 µL

CD53 (161-2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF405S conjugate, 0.1mg/mL
BNC042853-100 1x 100 µL

CD54 / ICAM-1 (15.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF594 conjugate, 0.1mg/mL
BNC941037-100 1x 100 µL

CD44 Standard (DF1485), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF405S conjugate, 0.1mg/mL
BNC040012-100 1x 100 µL

Tyrosinase (T311), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF555 conjugate, 0.1mg/mL
BNC550333-100 1x 100 µL

CD8 (RIV11), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (CIP1/823), CF647 conjugate, 0.1mg/mL
BNC470823-500 1x 500 µL

P21 / WAF1 (CIP1/823), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details