Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bat coronavirus 133/2005 Non-structural protein 3d (3d)

This Recombinant Bat coronavirus 133/2005 Non-structural protein 3d (3d) spans the amino acid sequence from region 1-227.

Product Specifications

Product Name Alternative

Non-structural protein 3d, ns3d, Accessory protein 3d

UniProt

Q0Q4E9

Expression Region

1-227

Origin

Bat coronavirus 133/2005 (BtCoV) (BtCoV/133/2005)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFSASLFRTKTVHTEDALCPRSAIQAEQPPNIIDCIPVAGYEAALVTNALFLLVLFVFN PLTCKGNWIKAILFYSLLLYNMILAIFLVIDTQHFVSALLLAYVVTFLILWTADRVRLSC AVGSVLPFVDMRSSYIRVDNGNSSVVVPMNHTKHWFIRNFEQSCHCENCFYIHSSSYVEC TFISRLKKSILVSVCDFSLGGNVSTVFVPSSDKTVPLHIIAPSKLYV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human 5-HT2A Alexa Fluor 700 Antibody (1055220)
FAB112501N-100UG 100 µg

Human 5-HT2A Alexa Fluor 700 Antibody (1055220)

Sign In for Pricing
View Details
NALCN Antibody, FITC conjugated
MBS7046042-01 0.05 mg

NALCN Antibody, FITC conjugated

Sign In for Pricing
View Details
NALCN Antibody, FITC conjugated
MBS7046042-02 0.1 mg

NALCN Antibody, FITC conjugated

Sign In for Pricing
View Details
NALCN Antibody, FITC conjugated
MBS7046042-03 5x 0.1 mg

NALCN Antibody, FITC conjugated

Sign In for Pricing
View Details
Human CCL25 (C-C motif chemokine 25) ELISA Kit
EH0065 96 Tests

Human CCL25 (C-C motif chemokine 25) ELISA Kit

Sign In for Pricing
View Details
PSG1 Over-expression Lysate Product
GWB-2A687F 0.1 mg

PSG1 Over-expression Lysate Product

Sign In for Pricing
View Details