Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bat coronavirus 133/2005 Non-structural protein 3d (3d)

This Recombinant Bat coronavirus 133/2005 Non-structural protein 3d (3d) spans the amino acid sequence from region 1-227.

Product Specifications

Product Name Alternative

Non-structural protein 3d, ns3d, Accessory protein 3d

UniProt

Q0Q4E9

Expression Region

1-227

Origin

Bat coronavirus 133/2005 (BtCoV) (BtCoV/133/2005)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFSASLFRTKTVHTEDALCPRSAIQAEQPPNIIDCIPVAGYEAALVTNALFLLVLFVFN PLTCKGNWIKAILFYSLLLYNMILAIFLVIDTQHFVSALLLAYVVTFLILWTADRVRLSC AVGSVLPFVDMRSSYIRVDNGNSSVVVPMNHTKHWFIRNFEQSCHCENCFYIHSSSYVEC TFISRLKKSILVSVCDFSLGGNVSTVFVPSSDKTVPLHIIAPSKLYV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rad51 (G-9) Alexa Fluor® 790
sc-377467 AF790 200 µg/mL

Rad51 (G-9) Alexa Fluor® 790

Sign In for Pricing
View Details
LATS2 Antibody
orb1263518 400 μl

LATS2 Antibody

Sign In for Pricing
View Details
Human recombinant TNF alpha protein, GMP
PROTP01375-9-1mg 1 mg

Human recombinant TNF alpha protein, GMP

Sign In for Pricing
View Details
Recombinant Cat Myosin light chain 5 (MYL5)
MBS953317-01 0.02 mg (E-Coli)

Recombinant Cat Myosin light chain 5 (MYL5)

Sign In for Pricing
View Details
Recombinant Cat Myosin light chain 5 (MYL5)
MBS953317-02 0.1 mg (E-Coli)

Recombinant Cat Myosin light chain 5 (MYL5)

Sign In for Pricing
View Details
Recombinant Cat Myosin light chain 5 (MYL5)
MBS953317-03 0.02 mg (Yeast)

Recombinant Cat Myosin light chain 5 (MYL5)

Sign In for Pricing
View Details